118

MAGEB1 antibody | 70R-4381

(No reviews yet) Write a Review
SKU:
118-70R-4381-GEN
Availability:
Usually ships in 5 working days
$2,835.00

Description

MAGEB1 antibody | 70R-4381 |

Activity Code: ACTIVE

Product Type: Primary Antibodies

Product Subtype: Purified Polyclonal Antibodies

Research Area: Signal Transduction

Short Description: Rabbit polyclonal MAGEB1 antibody raised against the middle region of MAGEB1

Immunogen: MAGEB1 antibody was raised using the middle region of MAGEB1 corresponding to a region with amino acids QEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLAKMNGATPRDF

Host: Rabbit

Specificity: MAGEB1 antibody was raised against the middle region of MAGEB1

Cross Reactivity: Human

Isotype: N/A

IClone: N/A

Species: N/A

Residues: N/A

Tag/conjugate: N/A

Protein Type: N/A

Expression System: N/A

Grade & Purity: N/A

Methode of Purification: Affinity purified

Source: N/A

Concentration: N/A

Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Shipping Information: *Blue Ice*

Applications: WB

Bioactivity: N/A

Usage Recommendations: WB: 1 ug/ml

Assay Information: MAGEB1 Blocking Peptide, catalog no. 33R-7528, is also available for use as a blocking control in assays to test for specificity of this MAGEB1 antibody

View AllClose

Additional Information

Size:
100 uL
View AllClose