223

MERS Coronavirus Envelope (HSZ-Cc) Recombinant Protein | 20-198

(No reviews yet) Write a Review
SKU:
223-20-198-GEN
zł5,808.00

Description

MERS Coronavirus Envelope (HSZ-Cc) Recombinant Protein | 20-198 | Gentaur UK, US & Europe Distribution

Tested Application: N/A

Application: N/A

Tpredicted Molecular Weight: Mono-Isotopic Mass: 53, 559.22 daltons
Average Mass: 53, 595.15 daltons

Physical State: Liquid

Buffer: 50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35

Storage Condition: Store at -70 °C. Avoid repeated freeze-thaw cycles.

Alternate Name: MERS-CoV-HSZ-Cc-E Protein, E Protein MERS-CoV-HSZ-Cc, Envelope Protein MERS-CoV-HSZ-Cc, MERS-CoV HSZ-Cc Envelope Protein

Background: N/A

Shipping: Dry Ice

Disclaimer: Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Source: bacteria

Species: MERS

By Source: Other

By Species: Other

Fusion Tag: N-Term MBP Uncleaved

Sequence: Native Sequence:
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELVKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSNNNNNNNNNNLGDDDDKVPEFLEVLFQGPLGSMLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCMTGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV

Amino acids M1 – V82 (end).
Residue M404 of the fusion protein is equivalent to M1 of the native enzyme.
The MBP tag is located at residues 1 – 367.

Protease Cleavage:
PreScission (LEVLFQGP) residues 393 – 400

Bological Activity: N/A

Purity: Amylose Resin (0.8)

View AllClose

Additional Information

Size:
0.1 mg
View AllClose