118

Neurog 3 Blocking Peptide | 33R-6941

(No reviews yet) Write a Review
SKU:
118-33R-6941-GEN
Availability:
Usually ships in 5 working days
€1,128.00
Frequently bought together:

Description

Neurog 3 Blocking Peptide | 33R-6941 |

Activity Code: ACTIVE

Product Type: Proteins

Research Area: Neuroscience

Short Description: A synthetic peptide for use as a blocking control in assays to test for specificity of Neurog 3 antibody, catalog no. 70R-7919

Immunogen: N/A

Host: N/A

Specificity: N/A

Cross Reactivity: N/A

Isotype: N/A

IClone: N/A

Species: N/A

Residues: NYIWALTQTLRIADHSFYGPEPPVPCGELGSPGGGSNGDWGSIYSPVSQA

Tag/conjugate: N/A

Protein Type: Synthetic

Expression System: N/A

Grade & Purity: N/A

Methode of Purification: N/A

Source: N/A

Concentration: N/A

Form & Buffer: Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage: Store sealed lyophilized serum at 4 deg C. Once open, store lyophilized at -20 deg C, reconstituted at 2-8 deg C (preservative added), or aliquoted at -20 deg C (no preservative added) .

Shipping Information: *Blue Ice*

Applications: WB, IHC

Bioactivity: N/A

View AllClose

Additional Information

Size:
100 ug
View AllClose