26
PACAP (human, chicken, mouse, ovine, porcine, rat) (6-38) | B1562
- SKU:
- 26-B1562-GEN
- Availability:
- Usually shipped in 5 working days
Description
PACAP (6-38) is a potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist (IC₅₀ = 2 nM). Inhibits PACAP (1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM).
PACAP (6-38) is a potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist (IC₅₀ = 2 nM). Inhibits PACAP (1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM).
B1562 | PACAP (human, chicken, mouse, ovine, porcine, rat) (6-38) DataSheet
Alternate Name/Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide-38 (6-38); FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
Appearance: Lyophilized solid
Formulation: N/A
CAS Number: 143748-18-9
Structure Available?: N/A
Peptide sequence: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂
Salt Form: TFA
Molecular Formula: C₁₈₂H₃₀₀N₅₆O₄₅S
Molecular Weight: 4024.8
Cell-Permeable?: Yes
Purity: ≥95%
Solubilities: H₂O (~ 2 mg/ml)
Handling: Protect from air and moisture
Country of Origin: USA
Tag Line: A potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist
MDL Number: N/A
PubChem CID: N/A
SMILES: N/A
InChi: N/A
InChi Key: N/A
Additional Information
Storage Condition: |
-20°C |
Shipping Condition: |
Gel Pack |
Shelf Life: |
36 months |