26

PACAP (human, chicken, mouse, ovine, porcine, rat) (6-38) | B1562

(No reviews yet) Write a Review
SKU:
26-B1562-GEN
Availability:
Usually shipped in 5 working days
£908.00

Description

PACAP (6-38) is a potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist (IC₅₀ = 2 nM). Inhibits PACAP (1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM).

PACAP (6-38) is a potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist (IC₅₀ = 2 nM). Inhibits PACAP (1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM).

B1562 | PACAP (human, chicken, mouse, ovine, porcine, rat) (6-38) DataSheet

Alternate Name/Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide-38 (6-38); FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂

Appearance: Lyophilized solid

Formulation: N/A

CAS Number: 143748-18-9

Structure Available?: N/A

Peptide sequence: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂

Salt Form: TFA

Molecular Formula: C₁₈₂H₃₀₀N₅₆O₄₅S

Molecular Weight: 4024.8

Cell-Permeable?: Yes

Purity: ≥95%

Solubilities: H₂O (~ 2 mg/ml)

Handling: Protect from air and moisture

Country of Origin: USA

Tag Line: A potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist

MDL Number: N/A

PubChem CID: N/A

SMILES: N/A

InChi: N/A

InChi Key: N/A

View AllClose

Additional Information

Storage Condition:
-20°C
Shipping Condition:
Gel Pack
Shelf Life:
36 months
View AllClose