PIGF1 protein (His Tag) | 30R-AP011

PIGF1 protein (His Tag) | 30R-AP011 |

Activity Code: ACTIVE

Product Type: Proteins

Product Subtype: Conjugated Proteins

Research Area: Cytokines & Growth Factors

Short Description: Purified recombinant Human PIGF1 protein (His Tag)

Immunogen:  

Host: N/A

Specificity: N/A

Cross Reactivity: N/A

Isotype: N/A

IClone: N/A

Species: Human

Residues: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSE VEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAPRRTRHHHHHH

Tag/conjugate: His tag

Protein Type: Binding Protein

Expression System: Sf-9 insect cells

Grade & Purity: > 95% pure

Methode of Purification: N/A

Source: N/A

Concentration: N/A

Form & Buffer: Supplied as a lyophilized powder.

Storage: Store at -20 deg C until reconstitution. Following reconstitution product may be stored at 4 deg C in the short term. For long term storage aliquot and freeze at -20 deg C. Avoid repeated freeze/thaw cycles.

Shipping Information: *Blue Ice*

Applications: User optimized

Bioactivity: N/A

Usage Recommendations: N/A

Assay Information: N/A