Recombinant Human DLK-1/Pref-1, soluble Protein [E. coli] | 400-020S/400-020

Recombinant Human DLK-1/Pref-1, soluble Protein [E. coli] | 400-020S/400-020 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: His-Tag

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: Protein delta homolog 1, pG2, Fetal antigen 1, FA1, ZOG

Isotype: N/A

Application: N/A

Detection Range: N/A

Species Reactivity/Cross reactivity: Human

Antigen: N/A

Description: Delta-like 1 (DLK1), also known as Pref-1 and FA1, is a transmembrane protein pertaining to the epidermal growth factor superfamily. DLK1 affects several differentiation processes, including adipogenesis, muscular and neuronal differentiation, bone differentiation, and haematopoiesis. Several reports support that DLK1 may operate as a non-canonical ligand of the NOTCH pathway. Since the NOTCH signaling pathway is essential for vascular development and physiology by controlling angiogenesis in pre- and post-natal life, it was reasoned that DLK1 could contribute to regulate this process in adult endothelial cells through the interaction with NOTCH receptors. It was found that overexpression of DLK1 inhibits migration and angiotube formation in mammalian vascular endothelial cells and disrupts normal embryonic vascularization in zebrafish. Genetic ablation of DLK1 in mice is associated with increased angiogenesis in vitro and with focal areas of retinal hyper-vascularization. Specific knockdown of the orthologous Dlk1 of zebrafish results in ectopic angiogenesis. Moreover, in a tumor angiogenesis model in zebrafish, suppression of Dlk1 promotes vessel migration towards the tumor cell mass. It was also found that the NOTCH signaling pathway is targeted by DLK1 in the context of angiogenesis and that DLK1 antagonizes NOTCH-dependent signaling in endothelial cells, while, in contrast, this signaling is enhanced in Dlk1-null mice. Collectively, these results revealed a previously unknown role for DLK1 in the vasculature as a regulator of NOTCH-mediated angiogenesis.

Purity Confirmation: > 98% by SDS-PAGE

Endotoxin: N/A

Formulation: lyophilized

Storage Handling Stability: N/A

Reconstituation: N/A

Molecular Weight: 30.2 kDa

Lenght (aa): 282

Protein Sequence: AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLEHHHHHH

NCBI Gene ID: 8788