Recombinant Human FABP5 Protein [E. coli] | 400-024S/400-024

Recombinant Human FABP5 Protein [E. coli] | 400-024S/400-024 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: His-Tag

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: Epidermal-type fatty acid-binding protein, E-FABP, Fatty acid-binding protein 5, Psoriasis-associated fatty acid-binding protein homolog, PA-FABP

Isotype: N/A

Application: N/A

Detection Range: Data not available.

Species Reactivity/Cross reactivity: Human

Antigen: N/A

Description: Human FABP5, also known as epidermal fatty acid binding protein (E-FABP), is a 15 kDa member of a cytosolic fatty acid binding protein superfamily. It is associated with keratinocytes and adipocytes and is suggested to promote fatty acid availability to enzymes, protect cell structures from fatty acid attack, and target fatty acids to nuclear transcription factors. The amino acid sequence of human FABP5 is 80%, 81% and 92% identical to that of mouse, rat and bovine FABP5, respectively.

Purity Confirmation: > 98% by SDS-PAGE & visualized by Coomassie stain

Endotoxin: N/A

Formulation: lyophilized

Storage Handling Stability: N/A

Reconstituation: N/A

Molecular Weight: 16.1 kDa

Lenght (aa): 143

Protein Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVETRHHHHHH

NCBI Gene ID: 2171