Recombinant Human FGF-4 Protein [E. coli] | 300-130/300-131

Recombinant Human FGF-4 Protein [E. coli] | 300-130/300-131 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: FGF4; HST; KFGF; HST-1; HSTF1; K-FGF; HBGF-4

Isotype: N/A

Application: N/A

Detection Range: The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).

Species Reactivity/Cross reactivity: Mouse, Rat, Human, Pig

Antigen: N/A

Description: FGF-4 (fibroblast growth factor 4), also known as K-FGF (Kaposi’s sarcoma associated FGF), is a 25 kDa secreted, heparin binding member of the FGF family. The human FGF-4 cDNA encodes 206 amino acids (aa) with a 33 aa signal sequence and a 173 aa mature protein with an FGF homology domain that contains a heparin binding region near the C terminus. Mature human FGF-4 shares a high aa identity with mouse, rat, canine and bovine FGF-4, respectively. The expression of FGF-4 and its receptors, FGF-R1c, -R2c, -R3c and R4, is spatially and temporally regulated during embryonic development. Its expression in the mouse trophoblast inner cell mass promotes expression of FGF-R2, and is required for maintenance of the trophectoderm and primitive endoderm. FGF-4 is proposed to play a physiologically relevant role in human embryonic stem cell self-renewal. It promotes stem cell proliferation, but may also aid differentiation depending on context and concentration, and is often included in embryonic stem cell media in-vitro. FGF-4 is mitogenic for fibroblasts and endothelial cells in-vitro and has autocrine transforming potential. It is a potent angiogenesis promoter in-vivo and has been investigated as therapy for coronary artery disease.

Purity Confirmation: > 95% by SDS-PAGE

Endotoxin: N/A

Formulation: lyophilized

Storage Handling Stability: The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted FGF-4 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles.

Reconstituation: We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for 1 week or -20°C for future use.

Molecular Weight: 19.7 kDa

Lenght (aa): 177

Protein Sequence: APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLP RL

NCBI Gene ID: 2249