209

Recombinant Human I-TAC (CXCL11) Protein [E. coli] | 100-058S/100-058

(No reviews yet) Write a Review
SKU:
209-100-058S/209-100-058-GEN
£908.00 - £1,210.00

Description

Recombinant Human I-TAC (CXCL11) Protein [E. coli] | 100-058S/100-058 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B

Isotype: N/A

Application: N/A

Detection Range: Determined by its ability to chemoattract IL-2 activated T-cells using a concentration range of 0.1-10.0 ng/ml.

Species Reactivity/Cross reactivity: Hamster, Mouse, Rabbit, Human, Monkey

Antigen: N/A

Description: Human I-TAC (Interferon-inducible T cell alpha chemoacttractant) is an 8.3 kDa protein containing 73 amino acid residues. I-TAC is a novel non-ELR CXC chemokine. It is regulated by Interferon and has potent chemoattractant activity for IL-2 activated T cells, but not for freshly isolated unstimulated T cells, neutrophils, or monocytes.

Purity Confirmation: > 98% by SDS-PAGE & HPLC analyses

Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)

Formulation: lyophilized

Storage Handling Stability: N/A

Reconstituation: N/A

Molecular Weight: 8.3 kDa

Lenght (aa): 73

Protein Sequence: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

NCBI Gene ID: 6373

View AllClose