209

Recombinant Human IL-1 receptor antagonist, soluble Protein [HEK 293 cells] | S01-061S/S01-061

(No reviews yet) Write a Review
SKU:
209-S01-061S/209-S01-061-GEN
zł2,724.00 - zł3,630.00

Description

Recombinant Human IL-1 receptor antagonist, soluble Protein [HEK 293 cells] | S01-061S/S01-061 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: HEK 293 cells

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Soluble Receptors

Category: Recombinant Protein

Synonyms: soluble IL-6 receptor alpha, B cell stimulatory factor-2, CD126

Isotype: N/A

Application: N/A

Detection Range: The ED50 was determined by its ability to intensify the IL-6 induced growth inhibition of murine M1 cells is ≤ 5.0 ng/ml, in the presence of 20 ng/ml of rhIL-6.

Species Reactivity/Cross reactivity: Mouse, Rat, Human

Antigen: N/A

Description: IL-6 mediates its biological effects through the type I IL-6 receptor system that consists of two chains, IL-6Rα and gp130. The IL-6Rα chain is the binding component specific to IL-6; while the gp130 only transmits signals of IL-6 when bound to IL-6Rα. The gp130 also can transmit signals from LIF, OSM, CNTF, IL-11 and CT-1 in conjunction with other receptor subunits. The low-affinity binding site for IL-6 is composed of IL-6Rα alone. IL-6Rα is expressed in a wide range of cells including T cells, fibroblasts and macrophages. Soluble IL-6Rα which consists of only the extracellular domain of the IL-6Rα chain, acts as an agonist of IL-6 activity at low concentrations. Recombinant human sIL-6Rα is a 37.6 kDa protein consisting of the extracellular domain of the IL-6Rα chain (339 amino acid residues).

Purity Confirmation: > 98% by SDS-PAGE & HPLC analysis

Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)

Formulation: lyophilized

Storage Handling Stability: N/A

Reconstituation: N/A

Molecular Weight: 37.2 kDa

Lenght (aa): 339

Protein Sequence: LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD

NCBI Gene ID: 3570

View AllClose