209

Recombinant Human IL-3 Protein [E. coli] | 200-015/200-016/200-015-SC

(No reviews yet) Write a Review
SKU:
209-200-015/209-200-016/209-200-015-SC-GEN
zł2,268.00 - zł4,134.00

Description

Recombinant Human IL-3 Protein [E. coli] | 200-015/200-016/200-015-SC | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: IL3; IL-3; MCGF; MULTI-CSF

Isotype: N/A

Application: N/A

Detection Range: The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is < 0.1 – 0.5 ng/ml. The WHO standard #91/510 was used as a control.

Species Reactivity/Cross reactivity: Human

Antigen: N/A

Description: IL-3 is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoieses, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is species-specific, variably glycosylated cytokine. Recombinant human IL-3 is a 15.0 kDa globular protein containing 133 amino acid residues.

Purity Confirmation: >98% by SDS-PAGE

Endotoxin: < 0.1 ng per µg (IEU/µg) of rh IL-3

Formulation: lyophilized

Storage Handling Stability: The lyophilized IL-3, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted IL-3 should be stored in working aliquots at -20°C.

Reconstituation: The lyophilized IL-3 should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.

Molecular Weight: 15.0 kDa

Lenght (aa): 134

Protein Sequence: MAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

NCBI Gene ID: 3562

View AllClose