209

Recombinant Human IL-36RA Protein [E. coli] | 100-414S/100-414

(No reviews yet) Write a Review
SKU:
209-100-414S/209-100-414-GEN
€1,362.00 - €1,815.00

Description

Recombinant Human IL-36RA Protein [E. coli] | 100-414S/100-414 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra homolog 1, IL-1 delta

Isotype: N/A

Application: N/A

Detection Range: Measured by its ability to inhibit IL-36γ induced IL-6 production by human PBMCs.

Species Reactivity/Cross reactivity: Human

Antigen: N/A

Description: The IL-1 family is comprised of 11 structurally related ligands, including the recently re-named IL-36RA (IL-1F5), IL-36α (IL-1F6), IL-36β (IL-1F8), and IL-36γ (IL-1F9). The interaction of IL-36 ligands with the IL-1Rrp2 receptor (IL-1R6) can induce various activities, including dendritic cell maturation and activation. IL-36RA can antagonize the NF-kappaB signaling induced by either IL-36α, -β or -γ by binding to the IL-1Rrp2 receptor in a manner that prevents the initiation of functional signaling. Recombinant human IL-36RA is an E. coli derived 17 kDa protein containing 154 amino acid residues.

Purity Confirmation: > 98% by SDS-PAGE & HPLC analyses

Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)

Formulation: lyophilized

Storage Handling Stability: N/A

Reconstituation: N/A

Molecular Weight: 17 kDa

Lenght (aa): 154

Protein Sequence: VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

NCBI Gene ID: 26525

View AllClose