Recombinant Human IP-10 (CXCL10) Protein [E. coli] | 100-057S/100-057

Recombinant Human IP-10 (CXCL10) Protein [E. coli] | 100-057S/100-057 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: CXCL10

Isotype: N/A

Application: N/A

Detection Range: Determined by its ability to chemoattract human T-Lymphocytes using a concentration of 10-50 ng/ml.

Species Reactivity/Cross reactivity: Monkey, Mouse, Leech, Human

Antigen: N/A

Description: IP-10 is a CXC chemokine that signals through the CXCR3 receptor. IP-10 selectively chemoattracts Th1 lymphocytes and monocytes, and inhibits cytokine-stimulated hematopoietic progenitor cell proliferation. Additionally, it is angiostatic and mitogenic for vascular smooth muscle cells. Recombinant human IP-10 is an 8.6 kDa protein consisting of 77 amino acids including the four conserved cysteine residues present in CXC chemokines.

Purity Confirmation: > 98% by SDS-PAGE & HPLC analyses

Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)

Formulation: lyophilized

Storage Handling Stability: N/A

Reconstituation: N/A

Molecular Weight: 8.6 kDa

Lenght (aa): 77

Protein Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

NCBI Gene ID: 3627