Recombinant Human OX40 ligand, soluble Protein [Insect cells] | S01-052S/S01-052

Recombinant Human OX40 ligand, soluble Protein [Insect cells] | S01-052S/S01-052 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: Insect cells

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Soluble Receptors

Category: Recombinant Protein

Synonyms: TNFSF4; GP34; CD252; OX4OL; TXGP1; CD134L; OX-40L; TAX transcriptionally-activated glycoprotein 1

Isotype: N/A

Application: N/A

Detection Range: Determined by its ability to stimulate IL-8 production by human PBMC using a concentration range of 30-100 ng/ml. Note: Results may vary with PBMC donors.

Species Reactivity/Cross reactivity: Human

Antigen: N/A

Description: OX40L, a member of the TNF superfamily of structurally related proteins, exists primarily as a type II membrane bound, non-covalently linked homotrimeric protein. It is expressed on antigen presenting cells (APCs), such as dendritic cells and activated B-cells, and also on various other cells such as vascular endothelial cells, mast cells, and natural killer cells. OX40L signals specifically through the OX40 receptor, which is expressed predominantly on CD4+T cells but also on certain activated CD8+T cells. OX40/OX40L functions as a costimulatory signal, which is required for a productive interaction between antigen presenting cells and their target T-cells. It enhances cell proliferation and survival, and increases expression of RANTES, IL-2, IL-3, and IFNγ. OX40/OX40L signaling plays an important role in immuno-regulatory communication, enabling the immune system to distinguish between “friend vs. foe” during activation; a mechanism typically termed immuno-tolerance. Recombinant OX40L is a glycosylated 133 amino acid protein corresponding to the extracellular TNF homologous domain of the full length transmembrane protein. It migrates with an apparent molecular mass of 15.5 – 25.0 kDa on SDS-PAGE.

Purity Confirmation: > 97% by SDS-PAGE & HPLC analyses

Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)

Formulation: lyophilized

Storage Handling Stability: N/A

Reconstituation: N/A

Molecular Weight: 15.5-25 kDa

Lenght (aa): 133

Protein Sequence: QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

NCBI Gene ID: 7292