209

Recombinant Human p16-INK4a Protein [E. coli] | 100-421S/100-421

(No reviews yet) Write a Review
SKU:
209-100-421S/209-100-421-GEN
£908.00 - £1,210.00

Description

Recombinant Human p16-INK4a Protein [E. coli] | 100-421S/100-421 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: Cyclin-dependent kinase inhibitor 2A, Cyclin-dependent kinase 4 inhibitor A, CDK4I, MTS-1, Multiple tumor suppressor 1

Isotype: N/A

Application: N/A

Detection Range: Data not available.

Species Reactivity/Cross reactivity: Human

Antigen: N/A

Description: p16-INK4a is a nuclear protein that regulates the cell cycle by inhibiting cyclin dependent kinase-4 (CDK4) and CDK6. p16-INK4a inhibits CDK activity by binding to the CDK molecules in a manner that interferes with their ability to interact with cyclin D. This activity has the effect of suppressing tumor formation and growth, and of inducing replicative senescence in various normal cells, including stem cells. The expression of p16-INK4a steadily increases with age and tends to accumulate in stem cell compartments. The deletion, rearrangement, or mutation of the p16-INK4a gene is frequently found in melanomas as well as in certain other types of cancer. Recombinant p16-INK4a is a 16.5 kDa protein containing 156 amino acid residues.

Purity Confirmation: > 95% by SDS-PAGE & HPLC analyses

Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)

Formulation: lyophilized

Storage Handling Stability: N/A

Reconstituation: N/A

Molecular Weight: 16.5 kDa

Lenght (aa): 156

Protein Sequence: MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

NCBI Gene ID: 1029

View AllClose