209

Recombinant Human VEGF-B167 Protein [E. coli] | 300-080S/300-080

(No reviews yet) Write a Review
SKU:
209-300-080S/209-300-080-GEN
$1,414.00 - $1,764.00

Description

Recombinant Human VEGF-B167 Protein [E. coli] | 300-080S/300-080 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: vascular endothelial growth factor B; VEGFB; VRF; VEGFL

Isotype: N/A

Application: N/A

Detection Range: Measured by its binding ability in a functional ELISA. Immobilized human sVEGFR-1/Flt-1 at 1 µg/mL (100 µL/well) can bind rhVEGF-B167 with a linear range of 0.5 ng/mL to 12.5 ng/mL.

Species Reactivity/Cross reactivity: Human

Antigen: N/A

Description: VEGF-B, a member of the VEGF family, is a potent growth and angiogenic cytokine. It promotes DNA synthesis in endothelial cells, helps regulate angiogenesis and vascular permeability, and inhibits apoptosis in certain smooth muscle cells and neurons. VEGF-B is expressed in all tissues except the liver. It forms cell surfaced-associated disulfide linked homodimers and can form heterodimers with VEGF-A. There are two known isoforms, formed by alternative splicing, which have been designated VEGF-B167 and VEGF-B186. Both forms have identical amino-terminal sequences encoding a “cysteine knot” like structural motif, but differ in their carboxyl-terminal domains. Both VEGF-B isoforms signal only through the VEGFR1 receptor. Recombinant human VEGF-B is a 38.0 kDa disulfide-linked homodimeric protein consisting of two 167 amino acid polypeptide chains.

Purity Confirmation: > 98% by SDS-PAGE & Coomassie stain

Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)

Formulation: lyophilized

Storage Handling Stability: Lyophilized samples are stable for greater than six months at –20°C to –70°C. Reconstituted VEGF-B167 should be stored in working aliquots at -20°C.

Reconstituation: The lyophilized VEGF-B167 should be reconstituted in water to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.

Molecular Weight: 38 kDa

Lenght (aa): 167

Protein Sequence: MPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDSPRPLCPRCTQHHQRPDPRTCRCRCRRRSFLRCQGRGLELNPDTCRCRKLRR

NCBI Gene ID: 7423

View AllClose