209

Recombinant Mouse BMP-4 Protein [E. coli] | M10-044S/M10-044

(No reviews yet) Write a Review
SKU:
209-M10-044S/209-M10-044-GEN
£908.00 - £1,210.00

Description

Recombinant Mouse BMP-4 Protein [E. coli] | M10-044S/M10-044 | Gentaur UK, US & Europe Distribution

Species: Mouse

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: Bmp4; bone morphogenetic protein 4; Bmp-4; Bmp2b; Bmp2b1; Bmp2b-1;

Isotype: N/A

Application: N/A

Detection Range: Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 5-15 ng/ml.

Species Reactivity/Cross reactivity: Mouse

Antigen: N/A

Description: Bone morphogenetic proteins (BMPs) constitute a subfamily within the TGF-β superfamily of structurally related signaling proteins. Members of this superfamily are widely distributed throughout the body and are involved in diverse physiological processes during both pre- and postnatal life. Like BMP-7, BMP-4 is involved in the development and maintenance of bone and cartilage. Reduced expression of BMP-4 is associated with a number of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. This E.coli derived murine BMP-4 is a fully active homodimeric protein consisting of two 106 amino acid subunits which correspond to amino acids 303-408 of the full length BMP-4 precursor.

Purity Confirmation: >98% by SDS-PAGE & HPLC analysis

Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)

Formulation: lyophilized

Storage Handling Stability: The lyophilized protein is stable at room temperature for 1 month and at 4°C for 6 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C.

Reconstituation: N/A

Molecular Weight: 23.9 kDa

Lenght (aa): 106

Protein Sequence: KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

NCBI Gene ID: 12159

View AllClose