209

Recombinant Mouse GM-CSF Protein [E. coli] | M30-012S/M30-012/M30-013/M10-238S

(No reviews yet) Write a Review
SKU:
209-M30-012S/209-M30-012/209-M30-013/209-M10-238S-GEN
£756.00 - £1,446.00

Description

Recombinant Mouse GM-CSF Protein [E. coli] | M30-012S/M30-012/M30-013/M10-238S | Gentaur UK, US & Europe Distribution

Species: Mouse

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: Csf2; Csfgm; GMCSF; Gm-CSf; MGI-IGM

Isotype: N/A

Application: N/A

Detection Range: Testing in Progress.

Species Reactivity/Cross reactivity: Mouse

Antigen: N/A

Description: GM-CSF is a hematopoietic growth factor that stimulates the development of neutrophils and macrophages and promotes the proliferation and development of early erythroid megakaryocytic and eosinophilic progenitor cells. It is produced in endothelial cells, monocytes, fibroblasts and T-lymphocytes. GM-CSF inhibits neutrophil migration and enhances the functional activity of the mature end-cells. The human and murine molecules are species-specific and exhibit no cross-species reactivity. Recombinant murine GM-CSF is a 14.2 kDa globular protein consisting of 124 amino acids residues.

Purity Confirmation: > 98% by SDS-PAGE

Endotoxin: < 0.1 ng per µg of GM-CSF

Formulation: lyophilized

Storage Handling Stability: The lyophilized mouse GM-CSF, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted mouse GM-CSF should be stored in working aliquots at -20°C.

Reconstituation: The lyophilized mouse GM-CSF is soluble in water and most aqueous buffers. It can be reconstituted in water to a concentration of 100 µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use. For most in vitro applications, mouse GM-CSF exerts its biological activity in the concentration range of 0.05 to 0.5ng/ml.

Molecular Weight: 14.2 kDa

Lenght (aa): 125

Protein Sequence: MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

NCBI Gene ID: 12981

View AllClose