209

Recombinant Mouse IP-10 (CXCL10) Protein [E. coli] | M10-025S/M10-025

(No reviews yet) Write a Review
SKU:
209-M10-025S/209-M10-025-GEN
€1,362.00 - €1,815.00

Description

Recombinant Mouse IP-10 (CXCL10) Protein [E. coli] | M10-025S/M10-025 | Gentaur UK, US & Europe Distribution

Species: Mouse

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: Cxcl10; C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10

Isotype: N/A

Application: N/A

Detection Range: Assay #1: Determined by its ability to chemoattract IL-2 activated T cells using a concentration range of 0.1-10.0 ng/ml. Assay #2: Determined by its ability to chemoattract CXCR3 transfected/HEK293 cells using a concentration range of 100-500 ng/ml.

Species Reactivity/Cross reactivity: Human, Mouse, Rat, Monkey

Antigen: N/A

Description: Murine IP-10 is produced by several cell types during the delayed type hypersensitivity response. IP-10 acts as a chemoattractant towards monocytes, lymphocytes, and certain T cells. Recombinant Murine IP-10 is a 8.7 kDa protein, containing 77 amino acid residues.

Purity Confirmation: > 98% by SDS-PAGE & HPLC analyses

Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)

Formulation: lyophilized

Storage Handling Stability: N/A

Reconstituation: N/A

Molecular Weight: 8.7 kDa

Lenght (aa): 77

Protein Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

NCBI Gene ID: 15945

View AllClose