209

Recombinant Mouse LIF Protein [E. coli] | M30-007/M30-008

(No reviews yet) Write a Review
SKU:
209-M30-007/209-M30-008-GEN
£924.00 - £1,362.00

Description

Recombinant Mouse LIF Protein [E. coli] | M30-007/M30-008 | Gentaur UK, US & Europe Distribution

Species: Mouse

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: Lif; leukemia inhibitory factor

Isotype: N/A

Application: N/A

Detection Range: The ED50 as determined by the M1 cell differentiation assay is in the range of 0.1 - 0.5 ng/ml.

Species Reactivity/Cross reactivity: Mouse

Antigen: N/A

Description: Leukemia Inhibitory Factor also called LIF is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone & fat metabolism, mitogenesis of factor dependent cell lines & promotion of megakaryocyte production in vivo. Human and mouse LIF exhibit a 78% identity in its amino acid sequence. Human LIF is as active on human cells as is it is on mouse cells, though mouse LIF is about 1000 fold less active on human cells, than human LIF. Recombinant mouse LIF produced in E. coli is a single, non-glycosylated, polypeptide chain containing 180 amino acids and having a molecular mass of 19.86 kDa.

Purity Confirmation: > 98% by SDS-PAGE

Endotoxin: < 0.1 ng per µg (IEU/µg) of rm LIF

Formulation: liquid

Storage Handling Stability: The lyophilized LIF, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted LIF should be stored in working aliquots at -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).

Reconstituation: The lyophilized LIF should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.

Molecular Weight: 19.86 kDa

Lenght (aa): 180

Protein Sequence: SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

NCBI Gene ID: 16878

View AllClose