Recombinant Mouse Lyve-1, soluble Protein [Insect cells] | S01-026

Recombinant Mouse Lyve-1, soluble Protein [Insect cells] | S01-026 | Gentaur UK, US & Europe Distribution

Species: Mouse

Host / biotech: Insect cells

Comment: N/A

Label: His-Tag

Clone / Antibody feature: N/A

Subcategory: Soluble Receptors

Category: Recombinant Protein

Synonyms: Lyve1; Xlkd1; Lyve-1; Crsbp-1; 1200012G08Rik

Isotype: N/A

Application: N/A

Detection Range: Not tested so far!

Species Reactivity/Cross reactivity: Mouse

Antigen: N/A

Description: A DNA sequence encoding the extracellular domain of mouse LYVE-1 (Met1 – Gly228) was fused to a C-terminal His-tag (6xHis) and expressed in insect cells. Based on N-terminal sequence analysis, the primary structure of recombinant mature sLYVE-1 starts at Ala24. sLYVE-1 has a calculated monomeric molecular mass of about 25 kDa but as a result of glycosylation, migrates at approximately 35 - 45 kDa under reducing conditions in SDS-PAGE. LYVE-1 has been identified as a major receptor for HA (extracellular matrix glycosaminoglycan hyaluronan) on the lymph vessel wall. The deduced amino acid sequence of LYVE-1 predicts a 322-residue type I integral membrane polypeptide 41% similar to the CD44 HA receptor with a 212-residue extracellular domain containing a single Link module the prototypic HA binding domain of the Link protein superfamily. Like CD44, the LYVE-1 molecule binds both soluble and immobilized HA. However, unlike CD44, the LYVE-1 molecule colocalizes with HA on the luminal face of the lymph vessel wall and is completely absent from blood vessels. Hence, LYVE-1 is the first lymph-specific HA receptor to be characterized and is a uniquely powerful marker for lymph vessels themselves.

Purity Confirmation: > 95% by SDS-PAGE

Endotoxin: N/A

Formulation: lyophilized

Storage Handling Stability: Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sLYVE-1 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles!

Reconstituation: The lyophilized sLYVE-1 is soluble in water and most aqueous buffers. The lyophilized sLYVE-1 should be reconstituted in PBS or medium to a concentration not lower than 50 µg/ml.

Molecular Weight: ~ 35.0 - 45.0 kDa

Lenght (aa): 211

Protein Sequence: ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAGHHHHHH

NCBI Gene ID: 114332