209

Recombinant Mouse PlGF Protein [Insect cells] | M30-019S/M30-019/M30-020

(No reviews yet) Write a Review
SKU:
209-M30-019S/209-M30-019/209-M30-020-GEN
zł2,424.00 - zł4,638.00

Description

Recombinant Mouse PlGF Protein [Insect cells] | M30-019S/M30-019/M30-020 | Gentaur UK, US & Europe Distribution

Species: Mouse

Host / biotech: Insect cells

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: Pgf; PlGF; Plgf; AI854365; placental growth factor

Isotype: N/A

Application: N/A

Detection Range: Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5 - 10 ng/mL.

Species Reactivity/Cross reactivity: Mouse

Antigen: N/A

Description: Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. All eight cysteine residues involved in intra and interchain disulfides are conserved among these growth factors. As a result of alternative splicing, three PlGF RNAs encoding monomeric human PlGF-1, PlGF-2 and PlGF-3 isoform precursors containing 149, 179 and 219 amino acid residues, respectively, have been described. In normal mouse tissues, only one mouse PlGF mRNA encoding the equivalent of human PlGF-2 has been identified. Mouse PlGF shares 65% amino acid identity with human PlGF-2. The gene for PlGF has been mapped to mouse chromosome 12 and human chromosome 14. PlGF binds with high affinity to Flt1, but not to Flk1/KDR.

Purity Confirmation: > 95% by SDS-PAGE

Endotoxin: N/A

Formulation: lyophilized

Storage Handling Stability: The lyophilized mouse PIGF, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C.

Reconstituation: Centrifuge vial prior to opening. The lyophilised PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use.

Molecular Weight: ~40 kDa

Lenght (aa): 135/132

Protein Sequence: ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP

NCBI Gene ID: 18654

View AllClose