209

Recombinant Rat VEGF-C152S Protein [Insect cells] | R20-016/R20-017

(No reviews yet) Write a Review
SKU:
209-R20-016/209-R20-017-GEN
NULL420.00 - NULL530.00

Description

Recombinant Rat VEGF-C152S Protein [Insect cells] | R20-016/R20-017 | Gentaur UK, US & Europe Distribution

Species: Rat

Host / biotech: Insect cells

Comment: N/A

Label: His-Tag

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: vascular endothelial growth factor C; Vegfc

Isotype: N/A

Application: N/A

Detection Range: (A) The proliferative response to rrVEGF-CC152S was assayed in VEGFR3-expressing porcine aortic endothelial (PAE) cells (in vitro). (B) The lymphangiogenic response to rrVEGF-CC152S loaded in a biopolymeric albumin-alginate microcapsules for targeted slow-release was assayed in male Wistar rats.

Species Reactivity/Cross reactivity: Rat

Antigen: N/A

Description: VEGF-C152S is a point mutant generated by the replacement of the second conserved Cys residue of the recombinant processed VEGF-C by a Ser residue. VEGF-C152S is analog to the human VEGF-C156S mutant and only active toward VEGFR-3/FLT-4 but, unlike wild type VEGF-C, is unable to bind to and to activate signalling through VEGFR-2/KDR. VEGF-C152S was inactive in the vascular permeability assay and did not increase migration of the capillary endothelial cells, indicating that these VEGF-like effects of VEGF-C require VEGFR-2 binding. VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. The rat VEGF-C cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant rat VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT-4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant rat VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A. The recombinant rat VEGF-C contains 127 amino acids residues and was fused to a His-tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.

Purity Confirmation: > 90% by SDS-PAGE

Endotoxin: N/A

Formulation: lyophilized

Storage Handling Stability: Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF-C152S should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles!

Reconstituation: The lyophilized VEGF-C152S is soluble in water and most aqueous buffers. The lyophilized VEGF-C152S should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml.

Molecular Weight: 18.0 - 24.0 kDa

Lenght (aa): 127

Protein Sequence: DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPSVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIHHHHHH

NCBI Gene ID: 114111

View AllClose