SARS-CoV-2 (COVID-19) NSP5 Recombinant Protein | 20-187

SARS-CoV-2 (COVID-19) NSP5 Recombinant Protein | 20-187 | Gentaur UK, US & Europe Distribution

Tested Application: N/A

Application: N/A

Tpredicted Molecular Weight: Mono-Isotopic Mass: 33, 796.64 daltons after tag cleavage
Average Mass: 33, 774.50 daltons after tag cleavage

Physical State: Liquid

Buffer: 50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35

Storage Condition: Store at -70 °C. Avoid repeated freeze-thaw cycles.

Alternate Name: SARS-CoV2-NSP5, SARS-CoV-2 NSP5, NSP5 SARS-CoV-2, 3CLPro, 3CL-Pro

Background: N/A

Shipping: Dry Ice

Disclaimer: Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Source: bacteria

Species: SARS-CoV-2

By Source: Other

By Species: Other

Fusion Tag: N-Term GST Cleaved, C-Term 6His Cleaved

Sequence: Native Sequence:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ

Amino acids S1 – Q306 (end).
Residue S237 of the fusion protein is equivalent to S1 of the native enzyme.
The GST tag is located at residues 1 – 220 and the His6 tag is located at residues 545– 550.
Has C-terminal 5’ residues of NSP4 (residues 232 – 236) between PreScission site and N-terminus of NSP5 – corresponding to the cleavage site between NSP4 and NSP5 in the polyprotein of the SARS CoV virus to generate an authentic N-terminus during gene expression. The C-terminus encodes for a modified PreScission cleavage site before the His6 tag to generate an authentic C-terminus when cleaved, SGVTFQGP, residues 537 - 544.

Protease Cleavage:
Modified PreScission - SGVTFQGP, residues 537 - 544

Bological Activity: N/A

Purity: Cobalt Agarose (0.9)