223

SARS-CoV-2 (COVID-19) NSP9 Recombinant Protein | 20-249

(No reviews yet) Write a Review
SKU:
223-20-249-GEN
€2,904.00

Description

SARS-CoV-2 (COVID-19) NSP9 Recombinant Protein | 20-249 | Gentaur UK, US & Europe Distribution

Tested Application: N/A

Application: N/A

Tpredicted Molecular Weight: Mono-Isotopic Mass: 39, 176.97 daltons
Average Mass: 39, 202.36 daltons

Physical State: Liquid

Buffer: 50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35

Storage Condition: Store at -70 °C. Avoid repeated freeze-thaw cycles.

Alternate Name: SARS-CoV2-NSP9, SARS-CoV-2 NSP9, NSP9 SARS-CoV-2

Background: N/A

Shipping: Dry Ice

Disclaimer: Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Source: bacteria

Species: SARS-CoV-2

By Source: Other

By Species: Other

Fusion Tag: N-Term GST Uncleaved

Sequence: Native Sequence:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ


Amino acids N1 – Q113 (end).
Residue N232 of the fusion protein is equivalent to M1 of the native enzyme.
The GST tag is located at residues 1 – 220.

Protease Cleavage:
PreScission (LEVLFQGP) residues 221 - 228

Bological Activity: N/A

Purity: GSH-Agarose (0.95)

View AllClose

Additional Information

Size:
0.1 mg
View AllClose