Description Additional Information Description SLC7A10 Antibody | 292-ASC-112AP Expression system: Yeast Purity: > 90% SDS-PAGE Suitable for: SDS-PAGE Product name Recombinant Mouse SLC7A10 protein (Tagged) Purity > 90 % SDS-PAGE. Expression system Yeast Accession P63115 Protein length Protein fragment Animal free No Nature Recombinant Species Mouse Sequence WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITD KPLKTQ Amino acids 475 to 530 Additional sequence information N-terminal 6xHis-sumostar-tagged View AllClose Additional Information Size: 100 µg View AllClose
Add to Cart Quick view SLC7A10 Antibody | 292-ASC-101AP 367 MSRP: Now: zł2,940.00 Was: SLC7A10 Antibody | 292-ASC-101AP from FabGennix.Product Type: Affinity PurifiedReactivity: Mouse/RatApplication: CM, ELISA, ICC, IF, IHC, IP, WBPurity: Affinity PurifiedConjugate/Tag/Label:... 292-ASC-101AP-GEN
Add to Cart Quick view SLC7A10 Antibody BIOTIN | 292-ASC.2-BIOTIN 367 MSRP: Now: zł3,384.00 Was: SLC7A10 Antibody BIOTIN | 292-ASC.2-BIOTIN from FabGennix.Product Type: BIOTIN-ConjugatedReactivity: Human/Mouse/RatApplication: CM, ELISA, ICC, IF, IHC, IP, WBPurity: Affinity... 292-ASC.2-BIOTIN-GEN
Add to Cart Quick view SLC7A10 Antibody FITC | 292-ASC.2-FITC 367 MSRP: Now: zł3,384.00 Was: SLC7A10 Antibody FITC | 292-ASC.2-FITC from FabGennix.Product Type: FITC-ConjugatedReactivity: Human/Mouse/RatApplication: CM, ELISA, ICC, IF, IHC, IP, WBPurity: Affinity PurifiedConjugate/Tag/Label:... 292-ASC.2-FITC-GEN
Add to Cart Quick view SLC7A10 Antibody | Gentaur Gentaur MSRP: Now: zł2,040.00 Was: SLC7A 292-ASC-112AP-GEN-GEN
Add to Cart Quick view PDE7A Antibody | 292-PD7A-112AP 367 MSRP: Now: zł2,658.00 Was: PDE7A Antibody | 292-PD7A-112AP from FabGennix.Product Type: Affinity PurifiedReactivity: Human/Mouse/RatApplication: ELISA, IP, WBPurity: Affinity PurifiedConjugate/Tag/Label: UnconjugatedTarget:... 292-PD7A-112AP-GEN