Additional Information
Size: |
100 µg |
Other Name: |
SUR2A Antibody: ATTO 488 |
Target: |
SUR2A |
Conjugate: |
ATTO 488 |
Research Area: |
Neuroscience, Cell Markers, Neuron Markers, Membrane Markers, Cell Signaling, Cancer |
Alternative Name(s): |
ABCC9 Antibody, Sulfonylurea receptor 2 Antibody, CMD10 Antibody, ABC37 Antibody, ATP-binding cassette transporter sub-family C member 9 Antibody, Sulfonylurea receptor 2A Antibody, isoform SUR2A Antibody |
Product Type: |
Monoclonal Antibody |
Clone Number: |
S319A-14 |
Immunogen: |
Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
Immunogen Species: |
Mouse |
Applications: |
WB, IHC, ICC/IF |
Host: |
Mouse |
Isotype: |
IgG2A |
Species Reactivity: |
Mouse, Rat |
Antibody Dilution: |
WB (1:1000); optimal dilutions for assays should be determined by the user. |
Purification: |
Protein G Purified |
Storage Buffer: |
PBS pH7.4, 50% glycerol, 0.1% sodium azide |
Concentration: |
1 mg/ml |
Specificity: |
Detects ~120kDa. Does not cross-react with SUR2B. |
Storage: |
-20ºC |
Shipping: |
Blue Ice or 4ºC |
Certificate of Analysis: |
1 µg/ml of SMC-431 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody. |
Cellular Localization: |
Membrane |
Accession Number: |
NP_001038185.1 |
Gene ID: |
20928 |
Swiss-Prot: |
P70170 |
Field of Use: |
Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only. |