Description
TC2N antibody | 70R-3749 |
Activity Code: ACTIVE
Product Type: Primary Antibodies
Product Subtype: Purified Polyclonal Antibodies
Research Area: Signal Transduction
Short Description: Rabbit polyclonal TC2N antibody raised against the middle region of TC2N
Immunogen: TC2N antibody was raised using the middle region of TC2N corresponding to a region with amino acids SWPSSYGDTPTVSIKGILTLPKPVHFKSSAKEGSNAIEFMETFVFAIKLQ
Host: Rabbit
Specificity: TC2N antibody was raised against the middle region of TC2N
Cross Reactivity: Human, Mouse
Isotype: N/A
IClone: N/A
Species: N/A
Residues: N/A
Tag/conjugate: N/A
Protein Type: N/A
Expression System: N/A
Grade & Purity: N/A
Methode of Purification: Affinity purified
Source: N/A
Concentration: N/A
Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping Information: *Blue Ice*
Applications: WB
Bioactivity: N/A
Usage Recommendations: WB: 1 ug/ml
Assay Information: TC2N Blocking Peptide, catalog no. 33R-8943, is also available for use as a blocking control in assays to test for specificity of this TC2N antibody
Related Products
TC2N Antibody | 26-710
223
IL-32 Antibody | 3749
223
ARL2BP Antibody | E19-3749
426
TC2N Blocking Peptide | 33R-8943
118
MFAP2 antibody | 70R-5452
118