USP48 antibody | 70R-1774

USP48 antibody | 70R-1774 |

Activity Code: ACTIVE

Product Type: Primary Antibodies

Product Subtype: Purified Polyclonal Antibodies

Research Area: Cell Biology

Short Description: Rabbit polyclonal USP48 antibody raised against the middle region of USP48

Immunogen: USP48 antibody was raised using the middle region of USP48 corresponding to a region with amino acids ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYV

Host: Rabbit

Specificity: USP48 antibody was raised against the middle region of USP48

Cross Reactivity: Human, Mouse, Rat, Dog

Isotype: N/A

IClone: N/A

Species: N/A

Residues: N/A

Tag/conjugate: N/A

Protein Type: N/A

Expression System: N/A

Grade & Purity: N/A

Methode of Purification: Total IgG Protein A purified

Source: N/A

Concentration: N/A

Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Shipping Information: *Blue Ice*

Applications: WB

Bioactivity: N/A

Usage Recommendations: WB: 2.5 ug/ml

Assay Information: USP48 Blocking Peptide, catalog no. 33R-1333, is also available for use as a blocking control in assays to test for specificity of this USP48 antibody