Human CellExp™ HMGB1 /HMG1, human recombinant | 7240

High-mobility group protein B1 (HMGB1), also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3. HMGB1 is a non-histone architectural chromosomal protein ubiquitously present in all vertebrate nuclei and binds double-stranded DNA without sequence specificity. It is also involved in inflammation and damage by binding to TLR4, which mediates HMGB1-dependent activation of macrophage cytokine release. This positions HMGB1 at the intersection of sterile and infectious inflammatory responses. HMGB1 has been studied as a DNA vaccine adjuvant and a target for cancer therapy.

7240 | Human CellExp HMGB1 /HMG1 human recombinant DataSheet

Biomolecule/Target: HMGB1

Synonyms: HMGB1, HMG1, HMG3, SBP-1

Alternates names: Glia maturation factor gamma, GMF-gamma, GMFG, MGC126867

Taglines: A DNA vaccine adjuvant and a target for cancer therapy.

NCBI Gene ID #: 9535

NCBI Gene Symbol: GMFG

Gene Source: Human

Accession #: O60234

Recombinant: Yes

Source: E. coli

Purity by SDS-PAGEs: 90%

Assay: SDS-PAGE

Purity: N/A

Assay #2: HPLC

Endotoxin Level: N/A

Activity (Specifications/test method): Measured by its binding ability in a functional ELISA HMGB1 is binding to immobilized human AGER-Fc tag protein (100 g/well) with a linear range of 0.31-2.5 µg/ml.

Biological activity: N/A

Results: N/A

Binding Capacity: Measured by its binding ability in a functional ELISA HMGB1 is binding to immobilized human AGER-Fc tag protein (100 g/well) with a linear range of 0.31-2.5 µg/ml.

Unit Definition: N/A

Molecular Weight: 16.8 kDa

Concentration: N/A

Appearance: Lyophilized powder

Physical form description: Lyophilized from 0.22 m filtered solution in PBS. Generally 5-8% Mannitol or trehalose is added as a protectant before lyophilization.

Reconstitution Instructions: N/A

Amino acid sequence: MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR