26

Human CellExp™ PD-1 /PDCD1, human recombinant | 7498

(No reviews yet) Write a Review
SKU:
26-7498-GEN
Availability:
Usually shipped in 5 working days
$1,410.50 - $10,157.00

Description

Programmed cell death 1 (PD1) is a cell surface membrane protein of the immunoglobulin superfamily. It is expressed on the surface of activated T cells, B cells, macrophages, myeloid cells and a subset of thymocytes. PD1 functions as an inhibitory cell su

7498 | Human CellExp PD-1 /PDCD1 human recombinant DataSheet

Biomolecule/Target: PD-1/PDCD1

Synonyms: PD, PD 1, PD 1 protein, PD 1 recombinant protein, human PD 1 protein, human recombinant PD 1 protein, human recombinant PD 1, human PD 1, recombinant PD 1, Human cell expressed PD 1, Human cell expressed PD 1 protein, Human cell expressed recombinant PD 1

Alternates names: Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.

Taglines: Inhibits the T-cell proliferation and production of IL-1, IL-4, IL-10 and IFN- by suppressing the activation and transduction of PI3K/AKT pathway.

NCBI Gene ID #: 22339

NCBI Gene Symbol: VEGFA

Gene Source: Mouse

Accession #: Q00731

Recombinant: Yes

Source: E. coli

Purity by SDS-PAGEs: 97%

Assay: SDS-PAGE

Purity: N/A

Assay #2: N/A

Endotoxin Level: N/A

Activity (Specifications/test method): N/A

Biological activity: The activity as determined by dose-dependent proliferation of human umbilical vein endothelial cells (HUVEC) was typically found to be 1-5 ng/ml.

Results: 1-5 ng/ml

Binding Capacity: Immobilized Human PD-1, His Tag at 5g/mL (100 L/well) can bind Human PD-L1, His Tag with a linear range of 0.15-1.25 g/mL

Unit Definition: N/A

Molecular Weight: 28.2 kDa

Concentration: N/A

Appearance: Lyophilized

Physical form description: Lyophilized from 0.22 m filtered solution in PBS pH 7.5

Reconstitution Instructions: Reconstitute the lyophilized product with sterile HO at a concentration of 0.1 – 0.5 mg/ml, which can be further diluted into other aqueous solutions

Amino acid sequence: MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR

View AllClose

Additional Information

Storage:
-20°C
Shipping:
Gel Pack
Shelf Life:
12 months
View AllClose