118
Integrin alpha 3A antibody 100 ug
- SKU:
- 118-10R-8071-100UG-GEN
- Availability:
- Usually ships in 5 working days
Additional Information
Size: |
100 ug |
Research area: |
Signal Transduction |
Immunogen: |
Integrin alpha 3A antibody was raised in Mouse using a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet he |
Host: |
Mouse |
Specificity: |
Reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A |
Cross Reactivity: |
Human |
Isotype: |
IgG2a |
Clone: |
158A3 |
Form: |
Supplied in PBS containing 0.09% sodium azide |
Storage: |
NA |
Shipping: |
NA |
Application: |
IHC, IHC-F, WB |