118
Integrin alpha 3B antibody 100 ug
- SKU:
- 118-10R-8072-100UG-GEN
- Availability:
- Usually ships in 5 working days
Additional Information
Size: |
100 ug |
Research area: |
Signal Transduction |
Immunogen: |
Integrin alpha 3B antibody was raised in Mouse using a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to |
Host: |
Mouse |
Specificity: |
Recognizes specifically the cytoplasmic domain of integrin subunit alpha3B which is present in microvascular structures in brain and heart |
Cross Reactivity: |
Human |
Isotype: |
IgG1 |
Clone: |
54B3 |
Form: |
Supplied in PBS containing 0.09% sodium azide |
Storage: |
NA |
Shipping: |
NA |
Application: |
IHC, IHC-F, WB |