209

Recombinant Human VEGF206 Protein [E. coli] | 300-098S/300-098/300-099

(No reviews yet) Write a Review
SKU:
209-300-098S/209-300-098/209-300-099-GEN
$1,617.00 - $3,178.00

Description

Recombinant Human VEGF206 Protein [E. coli] | 300-098S/300-098/300-099 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: Vascular endothelial growth factor A; VEGFA;VPF; VEGF; MVCD2

Isotype: N/A

Application: N/A

Detection Range: Testing under progress.

Species Reactivity/Cross reactivity: Human

Antigen: N/A

Description: Vascular endothelial growth factor-A (VEGF-A) mRNA undergoes alternative splicing events that generate several different homodimeric isoforms, e.g. VEGF121, VEGF145, VEGF165, VEGF189, and VEGF206. VEGF121 is a non-heparin-binding acidic protein, which is freely diffusible. The longer forms, VEGF189 or VEGF206, are highly basic proteins tightly bound to extracellular heparin-containing proteoglycans. VEGF165 has intermediate properties. VEGF165 was observed largely in Golgi apparatus-like structures. Immunogold labeling of cells expressing VEGF189 or VEGF206 revealed that the staining was localized to the subepithelial ECM. VEGF associated with the ECM was bioactive, because endothelial cells cultured on ECM derived from cells expressing VEGF189 or VEGF2O6 were markedly stimulated to proliferate. In addition, ECM-bound VEGF can be released into a soluble and bioactive form by heparin or plasmin. ECM-bound VEGF189 and VEGF206 have molecular masses consistent with the intact polypeptides. The ECM may represent an important source of VEGF and angiogenic potential. The isoforms VEGF145, VEGF165 and VEGF189 bind to heparin with high affinity, the affinity of VEGF206 is much weaker. All dimeric forms have similar biological activities but their bio­availability is very different. However so far there are only a few data about the biological activities of VEGF206.

Purity Confirmation: > 98% by SDS-PAGE

Endotoxin: N/A

Formulation: lyophilized

Storage Handling Stability: The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted VEGF206 should be stored in working aliquots at –20°C. Avoid repeated freeze-thaw cycles.

Reconstituation: The lyophilized VEGF206 should be reconstituted in 50mM acetic acid to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.

Molecular Weight: approx. 47 kDa

Lenght (aa): 206

Protein Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

NCBI Gene ID: 7422

View AllClose