GST-/GSTD2, Active Recombinant (Bombyx mori (Silk moth)) | 7840

Glutathione S-transferase is an enzyme in Bombyx mori (Silk moth) encoded by the GSTd2 gene. GSTs are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into nine classes: alpha, delta, kappa, mu, omega, pi, theta, zeta and microsomal. GSTs play a role in susceptibility to cancer, and other diseases.

7840 | GST-/GSTD2 Active Recombinant Bombyx mori Silk moth DataSheet

Biomolecule/Target: GST-/GSTD2

Synonyms: Glutathione S-Transferase Delta, GSTd2

Alternates names: Glutathione S-Transferase Delta, GSTd2

Taglines: 98% Pure Bombyx mori recombinant GST-/GSTD2, that plays an important role in detoxification.

NCBI Gene ID #: 14256

NCBI Gene Symbol: Flt3-L

Gene Source: Bombyx mori

Accession #: P49772

Recombinant: Yes

Source: E. coli

Purity by SDS-PAGEs: 98%

Assay: SDS-PAGE

Purity: N/A

Assay #2: N/A

Endotoxin Level: < 1.0 EU per 1 g of protein (determined by LAL method).

Activity (Specifications/test method): 20 U/mg as determined with ’s GST colorimetric activity assay kit, Cat # K263-100.

Biological activity: 20 U/mg as determined with ’s GST colorimetric activity assay kit, Cat # K263-100.

Results: 20 U/mg as determined with ’s GST colorimetric activity assay kit, Cat # K263-100.

Binding Capacity: N/A

Unit Definition: One unit of the recombinant GST- is defined as the amount of enzyme that conjugates 1.0 µmole of 1-chloro-2, 4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH 6.5 at 25°C.

Molecular Weight: 26.4 kDa (236 aa, 1-216 aa + His Tag)

Concentration: 2.0 mg/ml

Appearance: Liquid

Physical form description: 2.0 mg/ml solution in 30% glycerol without additives.

Reconstitution Instructions: N/A

Amino acid sequence: MGSSHHHHHHSSGLVPRGSH MTIDLYYVPG SAPCRAVLLT AKALNLNLNLKLVDLHHGEQLKPEYLKLNPQHTVPTLVDDG LSIWESRAIITYLVNKYAKGSSLYPEDPKARALVDQRLYFDIGTLYQRFSDYFYPQVFAGAPADKAKNEKVQ EALQLLDKFLEGQKYVAGPNLTVADLSLIASVSSLEASDIDFKKYAN VKRWYETVKSTAPGYQEANEKGLEAFKGLV NSMLKK